PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S05937.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 378aa    MW: 41382.8 Da    PI: 6.9354
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S05937.50genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like38.13.4e-123357125
        G2-like  1 kprlrWtpeLHerFveaveqLGGse 25
                   kprlrWt +LHerFv+av+qLGG++
  Jcr4S05937.50 33 KPRLRWTADLHERFVDAVAQLGGAN 57
                   79*********************86 PP

2G2-like51.32.6e-161301612455
        G2-like  24 sekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    + kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Jcr4S05937.50 130 HTKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 161
                    579****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-283058IPR009057Homeodomain-like
SuperFamilySSF466891.25E-6123163IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-10131162IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.1E-28133162IPR009057Homeodomain-like
PfamPF143794.6E-14205250IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MQVQMQHQNH TTSTQRIAAG GGEPCLVLTS DPKPRLRWTA DLHERFVDAV AQLGGANSLC  60
FSSFLFSSRS AVYCYSLTFL FAIFTNASFY LSLLHVYFMK LLCGQLGIQE VANSTNLDRP  120
LCRPFDETNH TKATPKAIMR TMNVKGLTLF HLKSHLQKYR LGKQSGKDIG EASKDGLSGS  180
YLLESPGGCN SSPNITTSDM NEGYEVKEAL RVQMEVQSKL YLQVEAEKHL QIREDAERRY  240
LAMLERACKM LADQFLGGTV IDTESQKGSA TKTPRSASLD PLGFQSLQTE AVSEVHGLEI  300
PSSLHHQGAD CSTESCLTSN ESPGGLTFEG SPAGGKKQMP SLDSPTASLI WGEAKVRTSE  360
VNTTQVNPHS ITGYGIWS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012082211.11e-180PREDICTED: myb family transcription factor APL-like
TrEMBLA0A067K9Q21e-180A0A067K9Q2_JATCU; Uncharacterized protein
STRINGPOPTR_0016s00320.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.12e-35G2-like family protein